PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_25971A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 240aa    MW: 26358.2 Da    PI: 10.7777
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_25971AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.5e-162066148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               + +WT eEd ll + v+++G +tW+ I++ ++ gR +k+c++rw ++l
  Oropetium_20150105_25971A 20 KSPWTREEDALLREQVRLHGARTWEVISAAVP-GRNAKSCRLRWCQHL 66
                               679*****************************.***********9986 PP

2Myb_DNA-binding41.43.4e-1375117347
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                ++T+ Ed   + + ++++++ W+tIa +++ gRt++ +k+rw+++
  Oropetium_20150105_25971A  75 PFTPREDAAVLALQRRYPNK-WATIAGYLP-GRTDNAIKNRWNSV 117
                                79******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.8971570IPR017930Myb domain
SuperFamilySSF466898.61E-2917114IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-181868IPR009057Homeodomain-like
SMARTSM007173.2E-151968IPR001005SANT/Myb domain
PfamPF002496.0E-152066IPR001005SANT/Myb domain
CDDcd001673.39E-142266No hitNo description
SMARTSM007175.0E-1272120IPR001005SANT/Myb domain
PROSITE profilePS5129417.72974122IPR017930Myb domain
PfamPF002492.8E-1175118IPR001005SANT/Myb domain
CDDcd001677.79E-1175118No hitNo description
Gene3DG3DSA:1.10.10.602.5E-1775119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MAVPDEEASS PTRGRPPMKK SPWTREEDAL LREQVRLHGA RTWEVISAAV PGRNAKSCRL  60
RWCQHLSPAV DAARPFTPRE DAAVLALQRR YPNKWATIAG YLPGRTDNAI KNRWNSVLRK  120
QQQQXXXXXX XXXXXTLALF RLAHGDVRTT ALVPPPVITP TTVEGDAQGG SSSCLNLFPL  180
ASGDIVSRSD AANQNSAAAP MDVDSARNEH LTQLRLFSLE TSTAARLSGR WMLQAVRAP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261612123127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457840.13e-69hypothetical protein SORBIDRAFT_03g015050
TrEMBLC5XKL13e-69C5XKL1_SORBI; Putative uncharacterized protein Sb03g015050
STRINGSb03g015050.19e-69(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.16e-36myb domain protein 77